Structure of PDB 1b0y Chain A

Receptor sequence
>1b0yA (length=85) Species: 1049 (Allochromatium vinosum) [Search protein sequence]
SAPANAVAADNATAIALKYNQDATKSERVAAARPGLPPEEQQCANCQFMQ
ADAAGATDEWKGCQLFPGKLINVNGWCASWTLKAG
3D structure
PDB1b0y Ab initio solution and refinement of two high-potential iron protein structures at atomic resolution.
ChainA
Resolution0.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 A Y19 C43 C46 F48 M49 C63 C77 W80 Y19 C43 C46 F48 M49 C63 C77 W80
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0019646 aerobic electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1b0y, PDBe:1b0y, PDBj:1b0y
PDBsum1b0y
PubMed10531472
UniProtP00260|HIP_ALLVD High-potential iron-sulfur protein (Gene Name=hip)

[Back to BioLiP]