Structure of PDB 1avc Chain A

Receptor sequence

>1avcA (length=642) Species: 9913 (Bos taurus)

YRGSIRDFPDFNPSQDAETLYNAMKGFGSDKEAIINLITSRSNKQRQEIC
QNYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYADAKEIKDAISGIG
TDEKCLIEILASRTNEQIHQLVAAYKDAYERDLEADITGDTSGHFRKMLV
VLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQ
HLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTAEYFAER
LFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDT
SGEYKKTLLKLCGGQFFPEAAQVAYQMWELSAVARVELKGTVRPAGDFNP
DADAKALRKAMKGLGTDEDTIIDIITHRSNAQRQQIRQTFKSHFGRDLMA
DLKSELSGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATR
TNAEIQAINKAYKEDYHKTLEDALSSDTSGHFKRILISLATGNREEGGED
RERAREDAQVAAEILTRFMMILCTRSYPDLRRVFQEFVKMTNYDVEHTIK
KEMSGDVRDVFVAIVQSVKNKPLFFADKLYKSMKGAGTEEKTLTRIMVSR
SEIDLLNIRREFIEKYDKSLHQAIEGDTSGHFLKALLAICGG

3D structure

• PDB: 1avc Crystal structure of bovine annexin VI in a calcium-bound state.
• Chain: A
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	M376 G378 L379 G380 T381 E420	M361 G363 L364 G365 T366 E405
BS02	CA	A	K75 L78 T79	K66 L69 T70
BS03	CA	A	M264 G266 L267 G268 T269 D308	M255 G257 L258 G259 T260 D299
BS04	CA	A	G188 E189 G193 E233	G179 E180 G184 E224
BS05	CA	A	M612 G614 A615 G616 D656	M583 G585 A586 G587 D627
BS06	CA	A	M448 E449 G450 G452 D492	M433 E434 G435 G437 D477

Gene Ontology

Molecular Function

• GO:0001786 phosphatidylserine binding
• GO:0005262 calcium channel activity
• GO:0005509 calcium ion binding
• GO:0005544 calcium-dependent phospholipid binding
• GO:0008201 heparin binding
• GO:0019899 enzyme binding
• GO:0035374 chondroitin sulfate binding
• GO:0038024 cargo receptor activity
• GO:0048306 calcium-dependent protein binding
• GO:0051015 actin filament binding

Biological Process

• GO:0003418 growth plate cartilage chondrocyte differentiation
• GO:0006816 calcium ion transport
• GO:0006937 regulation of muscle contraction
• GO:0016192 vesicle-mediated transport
• GO:0031214 biomineral tissue development
• GO:0051283 negative regulation of sequestering of calcium ion
• GO:0051560 mitochondrial calcium ion homeostasis
• GO:0070509 calcium ion import
• GO:0070588 calcium ion transmembrane transport
• GO:0097190 apoptotic signaling pathway

Cellular Component

• GO:0001725 stress fiber
• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0005925 focal adhesion
• GO:0012506 vesicle membrane
• GO:0016020 membrane
• GO:0030061 mitochondrial crista
• GO:0031982 vesicle
• GO:0042383 sarcolemma
• GO:0042470 melanosome
• GO:0042584 chromaffin granule membrane
• GO:0048471 perinuclear region of cytoplasm

External links

• PDB: RCSB:1avc, PDBe:1avc, PDBj:1avc
• PDBsum: 1avc
• PubMed: 9748523
• UniProt: P79134|ANXA6_BOVIN Annexin A6 (Gene Name=ANXA6)