Structure of PDB 1aui Chain A

Receptor sequence

>1auiA (length=378) Species: 9606 (Homo sapiens) [Search protein sequence]

TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALR
IITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRY
LFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIR
KLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYP
AVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD
VYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSSFEEAKGLDRINERMPPR

3D structure

PDB

1aui Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.

Chain

Resolution

2.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D90 H92 D118 D121 R122 N150 H151 H199 R254 H281
Catalytic site (residue number reindexed from 1)	D77 H79 D105 D108 R109 N137 H138 H186 R241 H268
Enzyme Commision number	3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	D118 N150 H199 H281	D105 N137 H186 H268
BS02	FE	A	D90 H92 D118	D77 H79 D105

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0004723	calcium-dependent protein serine/threonine phosphatase activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005516	calmodulin binding
GO:0016787	hydrolase activity
GO:0017018	myosin phosphatase activity
GO:0019899	enzyme binding
GO:0033192	calmodulin-dependent protein phosphatase activity
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding
GO:0046983	protein dimerization activity
GO:0051117	ATPase binding

	Biological Process
GO:0000082	G1/S transition of mitotic cell cycle
GO:0001975	response to amphetamine
GO:0006470	protein dephosphorylation
GO:0006606	protein import into nucleus
GO:0006816	calcium ion transport
GO:0008544	epidermis development
GO:0010613	positive regulation of cardiac muscle hypertrophy
GO:0010628	positive regulation of gene expression
GO:0010629	negative regulation of gene expression
GO:0014883	transition between fast and slow fiber
GO:0014898	cardiac muscle hypertrophy in response to stress
GO:0016311	dephosphorylation
GO:0019722	calcium-mediated signaling
GO:0023057	negative regulation of signaling
GO:0030216	keratinocyte differentiation
GO:0030335	positive regulation of cell migration
GO:0033173	calcineurin-NFAT signaling cascade
GO:0033555	multicellular organismal response to stress
GO:0042060	wound healing
GO:0042104	positive regulation of activated T cell proliferation
GO:0042110	T cell activation
GO:0043403	skeletal muscle tissue regeneration
GO:0045669	positive regulation of osteoblast differentiation
GO:0045672	positive regulation of osteoclast differentiation
GO:0045785	positive regulation of cell adhesion
GO:0045807	positive regulation of endocytosis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0046676	negative regulation of insulin secretion
GO:0046878	positive regulation of saliva secretion
GO:0048741	skeletal muscle fiber development
GO:0048813	dendrite morphogenesis
GO:0050774	negative regulation of dendrite morphogenesis
GO:0050804	modulation of chemical synaptic transmission
GO:0051592	response to calcium ion
GO:0060079	excitatory postsynaptic potential
GO:0061006	regulation of cell proliferation involved in kidney morphogenesis
GO:0070262	peptidyl-serine dephosphorylation
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade
GO:0071333	cellular response to glucose stimulus
GO:0090193	positive regulation of glomerulus development
GO:0097205	renal filtration
GO:0097720	calcineurin-mediated signaling
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:0110062	negative regulation of angiotensin-activated signaling pathway
GO:1903244	positive regulation of cardiac muscle hypertrophy in response to stress
GO:1905205	positive regulation of connective tissue replacement
GO:1905665	positive regulation of calcium ion import across plasma membrane
GO:1905949	negative regulation of calcium ion import across plasma membrane

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005955	calcineurin complex
GO:0008287	protein serine/threonine phosphatase complex
GO:0009898	cytoplasmic side of plasma membrane
GO:0019897	extrinsic component of plasma membrane
GO:0030018	Z disc
GO:0036057	slit diaphragm
GO:0042383	sarcolemma
GO:0042995	cell projection
GO:0043197	dendritic spine
GO:0045202	synapse
GO:0098685	Schaffer collateral - CA1 synapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1aui, PDBe:1aui, PDBj:1aui
PDBsum	1aui
PubMed	8524402
UniProt	Q08209\|PP2BA_HUMAN Protein phosphatase 3 catalytic subunit alpha (Gene Name=PPP3CA)

[Back to BioLiP]