Structure of PDB 1au7 Chain A

Receptor sequence
>1au7A (length=130) Species: 10116 (Rattus norvegicus) [Search protein sequence]
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQ
LSFKNACKLKAILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQE
IMRMAEELNLEKEVVRVWFCNRRQREKRVK
3D structure
PDB1au7 Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R20 Q27 Q44 T45 C48 N52 K103 R105 S128 R146 R153 Q154 R16 Q23 Q40 T41 C44 N48 K73 R75 S98 R116 R123 Q124
BS02 dna A F42 S43 T45 T46 R49 N59 K62 R105 T106 V147 N151 F38 S39 T41 T42 R45 N55 K58 R75 T76 V117 N121
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1au7, PDBe:1au7, PDBj:1au7
PDBsum1au7
PubMed9009203
UniProtP10037|PIT1_RAT Pituitary-specific positive transcription factor 1 (Gene Name=Pou1f1)

[Back to BioLiP]