Structure of PDB 1au1 Chain A

Receptor sequence
>1au1A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence]
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF
QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT
VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI
LRNFYFINRLTGYLRN
3D structure
PDB1au1 The crystal structure of human interferon beta at 2.2-A resolution.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 BGC A N80 T82 N80 T82
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005126 cytokine receptor binding
GO:0005132 type I interferon receptor binding
GO:0005515 protein binding
GO:0008811 chloramphenicol O-acetyltransferase activity
Biological Process
GO:0002250 adaptive immune response
GO:0002286 T cell activation involved in immune response
GO:0002312 B cell activation involved in immune response
GO:0002323 natural killer cell activation involved in immune response
GO:0006952 defense response
GO:0006959 humoral immune response
GO:0007166 cell surface receptor signaling pathway
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0009615 response to virus
GO:0010508 positive regulation of autophagy
GO:0019221 cytokine-mediated signaling pathway
GO:0030101 natural killer cell activation
GO:0030183 B cell differentiation
GO:0033141 positive regulation of peptidyl-serine phosphorylation of STAT protein
GO:0035458 cellular response to interferon-beta
GO:0042100 B cell proliferation
GO:0043330 response to exogenous dsRNA
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0045343 regulation of MHC class I biosynthetic process
GO:0045581 negative regulation of T cell differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051607 defense response to virus
GO:0060337 type I interferon-mediated signaling pathway
GO:0070050 neuron cellular homeostasis
GO:0071360 cellular response to exogenous dsRNA
GO:0098586 cellular response to virus
GO:0140123 negative regulation of Lewy body formation
GO:2000552 negative regulation of T-helper 2 cell cytokine production
GO:2001235 positive regulation of apoptotic signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1au1, PDBe:1au1, PDBj:1au1
PDBsum1au1
PubMed9342320
UniProtP01574|IFNB_HUMAN Interferon beta (Gene Name=IFNB1)

[Back to BioLiP]