Structure of PDB 1ap8 Chain A

Receptor sequence

>1ap8A (length=213) Species: 4932 (Saccharomyces cerevisiae)

MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKP
AVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDV
RPEWEDEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGETIDEDDSQIN
GVVLSIRKGGNKFALWTKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHS
SANGRHPQPSITL

3D structure

• PDB: 1ap8 Structure of translation factor eIF4E bound to m7GDP and interaction with 4E-binding protein.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	M7G	A	W58 D92 W104 E105 R157	W58 D92 W104 E105 R157

Gene Ontology

Molecular Function

• GO:0000340 RNA 7-methylguanosine cap binding
• GO:0003723 RNA binding
• GO:0003743 translation initiation factor activity
• GO:0005515 protein binding
• GO:0032266 phosphatidylinositol-3-phosphate binding
• GO:0098808 mRNA cap binding

Biological Process

• GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0006417 regulation of translation
• GO:0006446 regulation of translational initiation
• GO:0051726 regulation of cell cycle
• GO:1901195 positive regulation of formation of translation preinitiation complex

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0010494 cytoplasmic stress granule
• GO:0016281 eukaryotic translation initiation factor 4F complex

External links

• PDB: RCSB:1ap8, PDBe:1ap8, PDBj:1ap8
• PDBsum: 1ap8
• PubMed: 9302999
• UniProt: P07260|IF4E_YEAST Eukaryotic translation initiation factor 4E (Gene Name=CDC33)