Structure of PDB 1aoi Chain A

Receptor sequence
>1aoiA (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1aoi Crystal structure of the nucleosome core particle at 2.8 A resolution.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R40 Y41 R42 P43 R63 R72 R83 Q85 V117 T118 M120 R3 Y4 R5 P6 R26 R35 R46 Q48 V80 T81 M83
BS02 dna A H39 R40 Y41 P43 G44 T45 V46 A47 R49 R63 L65 R69 H2 R3 Y4 P6 G7 T8 V9 A10 R12 R26 L28 R32
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1aoi, PDBe:1aoi, PDBj:1aoi
PDBsum1aoi
PubMed9305837
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]