Structure of PDB 1an9 Chain A

Receptor sequence

>1an9A (length=340) Species: 9823 (Sus scrofa) [Search protein sequence]

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAG
LWQPYTSEPSNPQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLFRE
AVPDPYWKDMVLGFRKLTPRELDMFPDYRYGWFNTSLILEGRKYLQWLTE
RLTERGVKFFLRKVESFEEVARGGADVIINCTGVWAGVLQPDPLLQPGRG
QIIKVDAPWLKNFIITHDLERGIYNSPYIIPGLQAVTLGGTFQVGNWNEI
NNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFRPVRPQVRLEREQLRFGS
SNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEERNLL

3D structure

PDB

1an9 Structural and mechanistic studies on D-amino acid oxidase x substrate complex: implications of the crystal structure of enzyme x substrate analog complex.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	L51 G313 T317
Catalytic site (residue number reindexed from 1)	L51 G313 T317
Enzyme Commision number	1.4.3.3: D-amino-acid oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	I6 G7 A8 G9 I11 A36 D37 R38 T44 T45 A48 A49 G50 L51 V164 C181 T182 W185 G281 R283 G312 G313 Y314 G315 L316 T317	I6 G7 A8 G9 I11 A36 D37 R38 T44 T45 A48 A49 G50 L51 V164 C181 T182 W185 G281 R283 G312 G313 Y314 G315 L316 T317
BS02	BE2	A	L51 I215 Y224 Y228 R283	L51 I215 Y224 Y228 R283

Gene Ontology

	Molecular Function
GO:0003884	D-amino-acid oxidase activity
GO:0016491	oxidoreductase activity
GO:0071949	FAD binding

	Biological Process
GO:0006562	proline catabolic process
GO:0007586	digestion
GO:0019478	D-amino acid catabolic process
GO:0036088	D-serine catabolic process
GO:0042416	dopamine biosynthetic process
GO:0046416	D-amino acid metabolic process
GO:0055130	D-alanine catabolic process
GO:0070945	neutrophil-mediated killing of gram-negative bacterium

	Cellular Component
GO:0005576	extracellular region
GO:0005737	cytoplasm
GO:0005777	peroxisome
GO:0005782	peroxisomal matrix
GO:0005829	cytosol
GO:0042995	cell projection
GO:0045202	synapse
GO:0048786	presynaptic active zone

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1an9, PDBe:1an9, PDBj:1an9
PDBsum	1an9
PubMed	9399588
UniProt	P00371\|OXDA_PIG D-amino-acid oxidase (Gene Name=DAO)

[Back to BioLiP]