Structure of PDB 1aln Chain A

Receptor sequence

>1alnA (length=294) Species: 562 (Escherichia coli)

MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDED
ALAFALLPLAAACARTPLSNFNVGAIARGVSGTWYFGANMEFIGATMQQT
VHAEQSAISHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLP
GREAHALRDYLPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAAN
RSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPLQGALILLNLK
GYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHSIDRVLLA

3D structure

• PDB: 1aln Cytidine deaminase complexed to 3-deazacytidine: a "valence buffer" in zinc enzyme catalysis.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H102 E104 C129 C132
• Catalytic site (residue number reindexed from 1): H102 E104 C129 C132
• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H102 C129 C132	H102 C129 C132
BS02	CTD	A	V73 N89 E91 H102 Y126 T127	V73 N89 E91 H102 Y126 T127

Gene Ontology

Molecular Function

• GO:0001884 pyrimidine nucleoside binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006217 deoxycytidine catabolic process
• GO:0009972 cytidine deamination
• GO:0015949 nucleobase-containing small molecule interconversion
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1aln, PDBe:1aln, PDBj:1aln
• PDBsum: 1aln
• PubMed: 8634261
• UniProt: P0ABF6|CDD_ECOLI Cytidine deaminase (Gene Name=cdd)