Structure of PDB 1al8 Chain A

Receptor sequence

>1al8A (length=344) Species: 3562 (Spinacia oleracea)

MEITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPR
ILIDVTNIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAG
TIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFK
AIALTVDTPRLIKNRFVLPPFLTLKNFEGIDLGLSSYVAGQIDRSLSWKD
VAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPAT
IMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSL
AAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD

3D structure

• PDB: 1al8 Three-dimensional structures of glycolate oxidase with bound active-site inhibitors.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S106 Y129 T155 D157 K230 H254
• Catalytic site (residue number reindexed from 1): S106 Y129 T155 D157 K215 H239
• Enzyme Commision number: 1.1.3.15: (S)-2-hydroxy-acid oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	Y25 P77 T78 A79 S106 Q127 Y129 T155 K230 H254 R257 D285 G286 R289 G308 R309	Y25 P77 T78 A79 S106 Q127 Y129 T155 K215 H239 R242 D270 G271 R274 G293 R294
BS02	DHP	A	Y24 W108 Y129 F172 H254 R257	Y24 W108 Y129 F166 H239 R242	MOAD: Ki=4.8uM PDBbind-CN: -logKd/Ki=5.32,Ki=4.8uM

Gene Ontology

Molecular Function

• GO:0003973 (S)-2-hydroxy-acid oxidase activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0009853 photorespiration
• GO:0009854 oxidative photosynthetic carbon pathway
• GO:0051707 response to other organism

Cellular Component

• GO:0005777 peroxisome

External links

• PDB: RCSB:1al8, PDBe:1al8, PDBj:1al8
• PDBsum: 1al8
• PubMed: 9144771
• UniProt: P05414|GOX_SPIOL Glycolate oxidase