Structure of PDB 1aii Chain A

Receptor sequence
>1aiiA (length=322) Species: 9606 (Homo sapiens) [Search protein sequence]
ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNA
QRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKK
SMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGD
FRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEIL
CLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTP
AFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYS
AIKSDTSGDYEITLLKICGGDD
3D structure
PDB1aii Can enzymatic activity, or otherwise, be inferred from structural studies of annexin III?
ChainA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A I32 G34 G36 D76 I30 G32 G34 D74
BS02 CA A G187 R190 G192 E232 G185 R188 G190 E230
BS03 CA A K230 L233 E238 K228 L231 E236
BS04 CA A T193 E195 T191 E193
BS05 CA A M104 K105 G106 G108 E148 M102 K103 G104 G106 E146
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0004859 phospholipase inhibitor activity
GO:0005509 calcium ion binding
GO:0005544 calcium-dependent phospholipid binding
GO:0019834 phospholipase A2 inhibitor activity
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0006909 phagocytosis
GO:0010595 positive regulation of endothelial cell migration
GO:0021766 hippocampus development
GO:0031100 animal organ regeneration
GO:0042742 defense response to bacterium
GO:0043312 neutrophil degranulation
GO:0045766 positive regulation of angiogenesis
GO:0051054 positive regulation of DNA metabolic process
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051384 response to glucocorticoid
GO:0070848 response to growth factor
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0030670 phagocytic vesicle membrane
GO:0042581 specific granule
GO:0043025 neuronal cell body
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1aii, PDBe:1aii, PDBj:1aii
PDBsum1aii
PubMed9111038
UniProtP12429|ANXA3_HUMAN Annexin A3 (Gene Name=ANXA3)

[Back to BioLiP]