Structure of PDB 1ahr Chain A

Receptor sequence
>1ahrA (length=146) Species: 9031 (Gallus gallus) [Search protein sequence]
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD
MINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGFISA
AELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
3D structure
PDB1ahr The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V35
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D20 D22 D24 T26 E31 D20 D22 D24 T26 E31
BS02 CA A D56 D58 N60 T62 E67 D56 D58 N60 T62 E67
BS03 CA A D93 D95 N97 F99 E104 D91 D93 N95 F97 E102
BS04 CA A D129 D131 D133 Q135 E140 D127 D129 D131 Q133 E138
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0017022 myosin binding
GO:0046872 metal ion binding
GO:0051401 CH domain binding
GO:0097718 disordered domain specific binding
Cellular Component
GO:0005737 cytoplasm
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ahr, PDBe:1ahr, PDBj:1ahr
PDBsum1ahr
PubMed9195880
UniProtP62149|CALM_CHICK Calmodulin (Gene Name=CALM)

[Back to BioLiP]