Structure of PDB 1ag6 Chain A |
>1ag6A (length=99) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
VEVLLGGDDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGV DAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN |
|
PDB | 1ag6 Crystal structure of spinach plastocyanin at 1.7 A resolution. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H37 C84 H87 |
H37 C84 H87 |
|
|
|
|