Structure of PDB 1afj Chain A

Receptor sequence

>1afjA (length=72) Species: 623 (Shigella flexneri)

ATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDT
KASVQKLTKATADAGYPSSVKQ

3D structure

• PDB: 1afj Structures of the reduced and mercury-bound forms of MerP, the periplasmic protein from the bacterial mercury detoxification system.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HG	A	C14 C17	C14 C17

Gene Ontology

Molecular Function

• GO:0015097 mercury ion transmembrane transporter activity
• GO:0045340 mercury ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015694 mercury ion transport
• GO:0046689 response to mercury ion

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1afj, PDBe:1afj, PDBj:1afj
• PDBsum: 1afj
• PubMed: 9188683
• UniProt: P04129|MERP_SHIFL Mercuric transport protein periplasmic component (Gene Name=merP)