Structure of PDB 1afc Chain A

Receptor sequence

>1afcA (length=127) Species: 9913 (Bos taurus) [Search protein sequence]

KPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLAAESIGEVYIKST
ETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFV
GLKKNGRSKLGPRTHFGQKAILFLPLP

3D structure

PDB

1afc Structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GU4	A	K112 K113 N114 K118 Q127	K103 K104 N105 K109 Q118
BS02	YYJ	A	K112 R116 K118 R122	K103 R107 K109 R113

Gene Ontology

	Molecular Function
GO:0005104	fibroblast growth factor receptor binding
GO:0005178	integrin binding
GO:0005515	protein binding
GO:0008083	growth factor activity
GO:0008201	heparin binding
GO:0044548	S100 protein binding

	Biological Process
GO:0001525	angiogenesis
GO:0008284	positive regulation of cell population proliferation
GO:0008543	fibroblast growth factor receptor signaling pathway
GO:0009887	animal organ morphogenesis
GO:0010595	positive regulation of endothelial cell migration
GO:0010628	positive regulation of gene expression
GO:0030154	cell differentiation
GO:0030334	regulation of cell migration
GO:0030335	positive regulation of cell migration
GO:0032148	activation of protein kinase B activity
GO:0034605	cellular response to heat
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0045766	positive regulation of angiogenesis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051781	positive regulation of cell division
GO:0060681	branch elongation involved in ureteric bud branching
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0072163	mesonephric epithelium development
GO:1901509	regulation of endothelial tube morphogenesis
GO:1902533	positive regulation of intracellular signal transduction
GO:1903672	positive regulation of sprouting angiogenesis

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005938	cell cortex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1afc, PDBe:1afc, PDBj:1afc
PDBsum	1afc
PubMed	7520817
UniProt	P03968\|FGF1_BOVIN Fibroblast growth factor 1 (Gene Name=FGF1)

[Back to BioLiP]