Structure of PDB 1adw Chain A |
>1adwA (length=123) Species: 82367 (Paracoccus pantotrophus) [Search protein sequence] |
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILP EGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLD AAKTAKMPKKARERMDAELAQVN |
|
PDB | 1adw Pseudospecific docking surfaces on electron transfer proteins as illustrated by pseudoazurin, cytochrome c550 and cytochrome cd1 nitrite reductase. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|