Structure of PDB 1aca Chain A

Receptor sequence

>1acaA (length=86) Species: 9913 (Bos taurus)

SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFK
GKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI

3D structure

• PDB: 1aca Three-dimensional structure of the complex between acyl-coenzyme A binding protein and palmitoyl-coenzyme A.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	A	A9 K13 K18 Y28 Y31 K32 K50 K54	A9 K13 K18 Y28 Y31 K32 K50 K54

Gene Ontology

Molecular Function

• GO:0000062 fatty-acyl-CoA binding
• GO:0008289 lipid binding

Biological Process

• GO:0006631 fatty acid metabolic process

Cellular Component

• GO:0005783 endoplasmic reticulum
• GO:0005794 Golgi apparatus

External links

• PDB: RCSB:1aca, PDBe:1aca, PDBj:1aca
• PDBsum: 1aca
• PubMed: 8503960
• UniProt: P07107|ACBP_BOVIN Acyl-CoA-binding protein (Gene Name=DBI)