Structure of PDB 1aan Chain A |
>1aanA (length=105) Species: 266 (Paracoccus denitrificans) [Search protein sequence] |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREA MPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRG KVVVE |
|
PDB | 1aan Crystal structure analysis of amicyanin and apoamicyanin from Paracoccus denitrificans at 2.0 A and 1.8 A resolution. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H53 C92 H95 |
Catalytic site (residue number reindexed from 1) |
H53 C92 H95 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H53 C92 H95 |
H53 C92 H95 |
|
|
|
|