Structure of PDB 1aac Chain A |
>1aacA (length=105) Species: 266 (Paracoccus denitrificans) [Search protein sequence] |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREA MPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRG KVVVE |
|
PDB | 1aac X-ray structure of the cupredoxin amicyanin, from Paracoccus denitrificans, refined at 1.31 A resolution. |
Chain | A |
Resolution | 1.31 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H53 C92 H95 |
Catalytic site (residue number reindexed from 1) |
H53 C92 H95 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H53 C92 H95 |
H53 C92 H95 |
|
|
|
|