Structure of PDB 1a7s Chain A

Receptor sequence

>1a7sA (length=221) Species: 9606 (Homo sapiens) [Search protein sequence]

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFPGVSTVV
LGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSS
VTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC
RPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFT
RVALFRDWIDGVLNNPGPGPA

3D structure

PDB

1a7s Atomic resolution structure of human HBP/CAP37/azurocidin.

Chain

Resolution

1.12 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S41 D89 N172 G173 D174 G175 G176
Catalytic site (residue number reindexed from 1)	S41 D85 N168 G169 D170 G171 G172
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	EOH	A	R10 G56 A57 Y58	R10 G52 A53 Y54
BS02	EOH	A	F12 F14 Q124 V125 A126 P178 V180	F12 F14 Q120 V121 A122 P174 V176
BS03	EOH	A	I170 C171 G175 S190	I166 C167 G171 S186
BS04	EOH	A	Q19 V54 T70	Q19 V50 T66
BS05	EOH	A	R132 G135 R136	R128 G131 R132
BS06	EOH	A	Q153 P200 F202	Q149 P196 F198
BS07	EOH	A	T70 R97	T66 R93
BS08	EOH	A	Q94 P220 G221	Q90 P216 G217
BS09	EOH	A	P156 R205	P152 R201

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005515	protein binding
GO:0008201	heparin binding
GO:0008233	peptidase activity
GO:0015643	toxic substance binding
GO:0043395	heparan sulfate proteoglycan binding

	Biological Process
GO:0001774	microglial cell activation
GO:0006508	proteolysis
GO:0006935	chemotaxis
GO:0006954	inflammatory response
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0008347	glial cell migration
GO:0019730	antimicrobial humoral response
GO:0032724	positive regulation of fractalkine production
GO:0032731	positive regulation of interleukin-1 beta production
GO:0032760	positive regulation of tumor necrosis factor production
GO:0035556	intracellular signal transduction
GO:0035696	monocyte extravasation
GO:0042117	monocyte activation
GO:0042742	defense response to bacterium
GO:0043066	negative regulation of apoptotic process
GO:0043114	regulation of vascular permeability
GO:0045123	cellular extravasation
GO:0045348	positive regulation of MHC class II biosynthetic process
GO:0045785	positive regulation of cell adhesion
GO:0048246	macrophage chemotaxis
GO:0050766	positive regulation of phagocytosis
GO:0050829	defense response to Gram-negative bacterium
GO:0050930	induction of positive chemotaxis
GO:0051607	defense response to virus
GO:0060326	cell chemotaxis
GO:0070944	neutrophil-mediated killing of bacterium

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0016020	membrane
GO:0035577	azurophil granule membrane
GO:0035578	azurophil granule lumen
GO:0042582	azurophil granule
GO:0043231	intracellular membrane-bounded organelle
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1a7s, PDBe:1a7s, PDBj:1a7s
PDBsum	1a7s
PubMed	9761855
UniProt	P20160\|CAP7_HUMAN Azurocidin (Gene Name=AZU1)

[Back to BioLiP]