Structure of PDB 1a73 Chain A

Receptor sequence
>1a73A (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
3D structure
PDB1a73 DNA binding and cleavage by the nuclear intron-encoded homing endonuclease I-PpoI.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N119
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A A48 P49 G53 A55 K56 N57 K65 T67 A47 P48 G52 A54 K55 N56 K64 T66
BS02 dna A L116 N123 L115 N122
BS03 dna A N57 R61 Q63 R74 G76 T95 A96 H98 N56 R60 Q62 R73 G75 T94 A95 H97
BS04 ZN A C125 C132 H134 C138 C124 C131 H133 C137
BS05 ZN A C41 C100 C105 H110 C40 C99 C104 H109
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a73, PDBe:1a73, PDBj:1a73
PDBsum1a73
PubMed9665136
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]