Structure of PDB 1a70 Chain A

Receptor sequence

>1a70A (length=97) Species: 3562 (Spinacia oleracea)

AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGK
LKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

3D structure

• PDB: 1a70 Structure of the mutant E92K of [2Fe-2S] ferredoxin I from Spinacia oleracea at 1.7 A resolution.
• Chain: A
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	A	C39 R40 G42 C44 C47 C77	C39 R40 G42 C44 C47 C77

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0022900 electron transport chain

External links

• PDB: RCSB:1a70, PDBe:1a70, PDBj:1a70
• PDBsum: 1a70
• PubMed: 10089511
• UniProt: P00221|FER1_SPIOL Ferredoxin-1, chloroplastic (Gene Name=PETF)