Structure of PDB 1a6y Chain A

Receptor sequence
>1a6yA (length=78) Species: 9606 (Homo sapiens) [Search protein sequence]
LLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVR
INRNRCQQCRFKKCLSVGMSRDAVRFGR
3D structure
PDB1a6y Structural elements of an orphan nuclear receptor-DNA complex.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F111 H112 Y113 K122 R126 R168 V171 R172 F173 R175 F13 H14 Y15 K24 R28 R71 V74 R75 F76 R78
BS02 dna A E119 G120 R127 R150 N151 Q154 R157 E21 G22 R29 R53 N54 Q57 R60
BS03 ZN A C101 C104 C121 C3 C6 C23
BS04 ZN A C137 C143 C153 C156 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a6y, PDBe:1a6y, PDBj:1a6y
PDBsum1a6y
PubMed9660968
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]