Structure of PDB 1a6q Chain A

Receptor sequence
>1a6qA (length=363) Species: 9606 (Homo sapiens) [Search protein sequence]
GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLE
SWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGI
RTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLL
CRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFD
YKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELC
DFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEA
VKKEAELDKYLECRVEEIIKGVPDLVHVMRTLASENIPSLPPGGELASKR
NVIEAVYNRLNPY
3D structure
PDB1a6q Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A D60 D239 D282 D59 D238 D281
BS02 MN A E37 D60 G61 E36 D59 G60
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0017018 myosin phosphatase activity
GO:0030145 manganese ion binding
GO:0033192 calmodulin-dependent protein phosphatase activity
GO:0043169 cation binding
GO:0046872 metal ion binding
GO:0070412 R-SMAD binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006470 protein dephosphorylation
GO:0006499 N-terminal protein myristoylation
GO:0006611 protein export from nucleus
GO:0016311 dephosphorylation
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030514 negative regulation of BMP signaling pathway
GO:0035970 peptidyl-threonine dephosphorylation
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043124 negative regulation of canonical NF-kappaB signal transduction
GO:0045893 positive regulation of DNA-templated transcription
GO:0046827 positive regulation of protein export from nucleus
GO:0051726 regulation of cell cycle
GO:0071560 cellular response to transforming growth factor beta stimulus
GO:0090263 positive regulation of canonical Wnt signaling pathway
GO:1901223 negative regulation of non-canonical NF-kappaB signal transduction
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1a6q, PDBe:1a6q, PDBj:1a6q
PDBsum1a6q
PubMed9003755
UniProtP35813|PPM1A_HUMAN Protein phosphatase 1A (Gene Name=PPM1A)

[Back to BioLiP]