Structure of PDB 1a5x Chain A |
>1a5xA (length=146) Species: 11889 (Rous sarcoma virus (strain Schmidt-Ruppin)) [Search protein sequence] |
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQH HWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQ AMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF |
|
PDB | 1a5x Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
Y3 |
A |
Q62 K119 A154 M155 |
Q9 K66 A101 M102 |
|
|
|
|