Structure of PDB 1a4v Chain A

Receptor sequence
>1a4vA (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]
KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEY
GLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKG
IDYWLAHKALCTEKLEQWLCEKL
3D structure
PDB1a4v Structural evidence for the presence of a secondary calcium binding site in human alpha-lactalbumin.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T33 N45 S47 E49 S56
Catalytic site (residue number reindexed from 1) T33 N45 S47 E49 S56
Enzyme Commision number 2.4.1.22: lactose synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A K79 D82 D84 D87 D88 K79 D82 D84 D87 D88
BS02 CA A T38 Q39 L81 D82 D83 T38 Q39 L81 D82 D83
Gene Ontology
Molecular Function
GO:0003796 lysozyme activity
GO:0004461 lactose synthase activity
GO:0005509 calcium ion binding
GO:0046872 metal ion binding
Biological Process
GO:0005989 lactose biosynthetic process
GO:0006915 apoptotic process
GO:0007165 signal transduction
GO:0007267 cell-cell signaling
GO:0042742 defense response to bacterium
Cellular Component
GO:0000139 Golgi membrane
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005796 Golgi lumen
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1a4v, PDBe:1a4v, PDBj:1a4v
PDBsum1a4v
PubMed9537992
UniProtP00709|LALBA_HUMAN Alpha-lactalbumin (Gene Name=LALBA)

[Back to BioLiP]