Structure of PDB 1a2i Chain A

Receptor sequence

>1a2iA (length=107) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough)

APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAG
CHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGC
KKSKCHE

3D structure

• PDB: 1a2i Solution structure of Desulfovibrio vulgaris (Hildenborough) ferrocytochrome c3: structural basis for functional cooperativity.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	K3 A4 P5 M11 F20 H22 H25 V28 C30 C33 H34 Y43 R44 K45 C46	K3 A4 P5 M11 F20 H22 H25 V28 C30 C33 H34 Y43 R44 K45 C46
BS02	HEC	A	C33 H35 C46 C51 H52 S61 H67 V68 T74 K75 F76	C33 H35 C46 C51 H52 S61 H67 V68 T74 K75 F76
BS03	HEC	A	F20 T24 H25 D32 C33 C79 C82 H83 V86 L97 K104	F20 T24 H25 D32 C33 C79 C82 H83 V86 L97 K104
BS04	HEC	A	M11 A13 T14 Q16 V18 Y65 Y66 H70 V80 H83 L97 T98 G99 C100 C105 H106	M11 A13 T14 Q16 V18 Y65 Y66 H70 V80 H83 L97 T98 G99 C100 C105 H106

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1a2i, PDBe:1a2i, PDBj:1a2i
• PDBsum: 1a2i
• PubMed: 9710542
• UniProt: P00131|CYC3_NITV2 Cytochrome c3 (Gene Name=DVU_3171)