Structure of PDB 1a27 Chain A

Receptor sequence

>1a27A (length=285) Species: 9606 (Homo sapiens)

ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAAR
ALACPPGSLETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLE
ALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGLP
FNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSP
EEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPT
LRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFG

3D structure

• PDB: 1a27 Structure of Human Estrogenic 17 Beta-Hydroxysteroid Dehydrogenase at 2.20 A Resolution
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.51: 3(or 17)beta-hydroxysteroid dehydrogenase.
  1.1.1.62: 17beta-estradiol 17-dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EST	A	S142 V143 G144 M147 L149 Y155 V225 F259 M279	S142 V143 G144 M147 L149 Y155 V225 F259 M279
BS02	NAP	A	G9 S11 S12 G13 R37 D65 V66 N90 A91 G92 T140 S142 K159 C185 G186 P187 V188 T190 F192	G9 S11 S12 G13 R37 D65 V66 N90 A91 G92 T140 S142 K159 C185 G186 P187 V188 T190 F192

Gene Ontology

Molecular Function

• GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0006703 estrogen biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1a27, PDBe:1a27, PDBj:1a27
• PDBsum: 1a27
• UniProt: P14061|DHB1_HUMAN 17-beta-hydroxysteroid dehydrogenase type 1 (Gene Name=HSD17B1)