Structure of PDB 1a1l Chain A

Receptor sequence
>1a1lA (length=85) Species: 10090 (Mus musculus) [Search protein sequence]
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
3D structure
PDB1a1l High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R103 F116 R118 R124 H125 R142 R146 H149 H153 T156 R174 E177 R180 R1 F14 R16 R22 H23 R40 R44 H47 H51 T54 R72 E75 R78
BS02 dna A D148 S175 K179 D46 S73 K77
BS03 ZN A C107 C112 H125 H129 C5 C10 H23 H27
BS04 ZN A C137 C140 H153 H157 C35 C38 H51 H55
BS05 ZN A C165 C168 H181 H185 C63 C66 H79 H83
External links
PDB RCSB:1a1l, PDBe:1a1l, PDBj:1a1l
PDBsum1a1l
PubMed9562555
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]