Structure of PDB 11bg Chain A
Receptor sequence
| >11bgA (length=124) Species: 9913 (Bos taurus) [Search protein sequence] |
| KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHES LADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTT QVEKHIIVACGGKPSVPVHFDASV |
3D structure
| PDB | 11bg A potential allosteric subsite generated by domain swapping in bovine seminal ribonuclease. | ||
| Chain | A | ||
| Resolution | 1.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Catalytic site (original residue number in PDB) | H12 K41 H119 F120 D121 |
| Catalytic site (residue number reindexed from 1) | H12 K41 H119 F120 D121 |
| Enzyme Commision number | 4.6.1.18: pancreatic ribonuclease. |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | U2G | A | V43 N44 T45 K66 K104 F120 A122 S123 | V43 N44 T45 K66 K104 F120 A122 S123 | |
| BS02 | U2G | A | N24 N94 | N24 N94 | |
| BS03 | U2G | A | K39 K41 | K39 K41 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003676 | nucleic acid binding |
| GO:0004519 | endonuclease activity |
| GO:0004522 | ribonuclease A activity |
| GO:0004540 | RNA nuclease activity |
| GO:0016829 | lyase activity |
| GO:0042802 | identical protein binding |
