Structure of PDB 10mh Chain A

Receptor sequence

>10mhA (length=327) Species: 726 (Haemophilus haemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 10mh Mechanism of inhibition of DNA (cytosine C5)-methyltransferases by oligodeoxyribonucleotides containing 5,6-dihydro-5-azacytosine.
• Chain: A
• Resolution: 2.55 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I86 Q90 R209 G236 Q237 G256 G257	I86 Q90 R209 G236 Q237 G256 G257
BS02	dna	A	F79 C81 S87 E119 R165 R228 Q237 R240 I249 T250 A253 Y254 G255 G303	F79 C81 S87 E119 R165 R228 Q237 R240 I249 T250 A253 Y254 G255 G303
BS03	SAH	A	F18 A19 G20 L21 G23 E40 W41 D60 N304 S305	F18 A19 G20 L21 G23 E40 W41 D60 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:10mh, PDBe:10mh, PDBj:10mh
• PDBsum: 10mh
• PubMed: 9925782
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)