Structure of PDB 3j77 Chain 93

Receptor sequence
>3j7793 (length=91) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain93
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 93 Q25 K28 R84 Q24 K27 R83
BS02 rna 93 A2 R4 T5 K7 V8 G9 I10 K13 Y14 G15 V16 R17 Y18 S20 R23 H34 F41 K44 R49 A51 A1 R3 T4 K6 V7 G8 I9 K12 Y13 G14 V15 R16 Y17 S19 R22 H33 F40 K43 R48 A50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)

[Back to BioLiP]