Structure of PDB 7zq9 Chain 92

Receptor sequence

>7zq992 (length=184) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

ARPTWLPGLNPPAHLKGALAGDNGFDPLGLGQDEGRLKWYAEAEKTNGRW
AMMAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIVMGFLEIKR
YQGFKQTGTSGFINSFPFDPAGMNSPSMATKEVKNGRLAMVAFIGFCVQA
LATRTQPIEGLTAHLADPFGKNITYYLTHLPETL

3D structure

PDB

7zq9 Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.

Chain

Resolution

2.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	92	L54 L56	L28 L30
BS02	CLA	92	W31 L32 P33 N49 F51	W5 L6 P7 N23 F25
BS03	CLA	92	D48 N49 F51 D52 L56 G57 Y66 E70 N73 R163 M166 V167	D22 N23 F25 D26 L30 G31 Y40 E44 N47 R137 M140 V141
BS04	CLA	92	Y66 A69 N73 I170	Y40 A43 N47 I144
BS05	CLA	92	A80 G83 Q87 V92 A99	A54 G57 Q61 V66 A73
BS06	CHL	92	W76 A99 Y104 L111 E115	W50 A73 Y78 L85 E89
BS07	CHL	92	W97 G100 A101 E115	W71 G74 A75 E89
BS08	CLA	92	W65 A69 T72 N73 W76 E123 R126	W39 A43 T46 N47 W50 E97 R100
BS09	CLA	92	R75 M78 M79 S136 G137 P143 F144 M149 E158	R49 M52 M53 S110 G111 P117 F118 M123 E132
BS10	CLA	92	K157 K160 N161	K131 K134 N135
BS11	CLA	92	M154 K157 N161 L164	M128 K131 N135 L138
BS12	CLA	92	V167 G171 V174 Q175 T179 G186 K197 I199	V141 G145 V148 Q149 T153 G160 K171 I173
BS13	CLA	92	H190 P194	H164 P168

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zq9, PDBe:7zq9, PDBj:7zq9
PDBsum	7zq9
PubMed	36229605
UniProt	A8ITV3

[Back to BioLiP]