Structure of PDB 3j77 Chain 92

Receptor sequence

>3j7792 (length=105) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	92	N3 P5 R8 K9 T10 Y11 K13 K15 K19 H20 Y28 K32 F36 A37 Q38 R41 R42 R45 K46 S48 G49 F50 G52 Q53 P56 V57 F58 H59 K60 A62 K63 K67 R71 T79 R80 Q82 R87 C88 K89 K97 K98	N2 P4 R7 K8 T9 Y10 K12 K14 K18 H19 Y27 K31 F35 A36 Q37 R40 R41 R44 K45 S47 G48 F49 G51 Q52 P55 V56 F57 H58 K59 A61 K62 K66 R70 T78 R79 Q81 R86 C87 K88 K96 K97
BS02	rna	92	K40 Y43	K39 Y42

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P0CX27\|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)