Structure of PDB 8uri Chain 9

Receptor sequence
>8uri9 (length=148) Species: 562 (Escherichia coli) [Search protein sequence]
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGV
YMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFA
KANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASA
3D structure
PDB8uri Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
Chain9
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 9 N4 D7 K8 R31 R56 T58 L59 R61 R62 T80 L81 N4 D7 K8 R31 R56 T58 L59 R61 R62 T80 L81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uri, PDBe:8uri, PDBj:8uri
PDBsum8uri
PubMed39117885
UniProtP0A7J3|RL10_ECOLI Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]