Structure of PDB 8q5i Chain 9

Receptor sequence

>8q5i9 (length=125) Species: 5476 (Candida albicans) [Search protein sequence]

AKISQDVSSSRSKARKAYFTASSVERRVLLSAPLSKELRQQYNVKSLPIR
QNDEVLVVRGSKKGSEGKVNSVYRLKFAIQVDKLQKEKSNGASVPINIHP
SKVVITKLHLDKDRKALIQRKGGKA

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	9	A2 K3 I4 S5 Q6 V8 S9 S10 R12 K14 A15 R16 Y19 L30 S32 P34 S47 R60 G61 S62 K87 K89 S90 H100 S102 K103 R121 K122	A1 K2 I3 S4 Q5 V7 S8 S9 R11 K13 A14 R15 Y18 L29 S31 P33 S46 R59 G60 S61 K86 K88 S89 H99 S101 K102 R120 K121
BS02	rna	9	R12 S13 R16 K17 F20 S24 R28 R51 Q52 V73 Y74 R75 L76 L111 D112 K113 D114 K116 R121	R11 S12 R15 K16 F19 S23 R27 R50 Q51 V72 Y73 R74 L75 L110 D111 K112 D113 K115 R120

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links