Structure of PDB 8pw6 Chain 9

Receptor sequence
>8pw69 (length=178) Species: 10090 (Mus musculus) [Search protein sequence]
TYKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATI
NYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEP
RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELL
YNKEKLLNNGDKWEAEIAANIQADYLYR
3D structure
PDB8pw6 SCAF1 drives the compositional diversity of mammalian respirasomes.
Chain9
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 9 H67 C89 P90 I94 C118 I119 Y120 C121 G122 C124 H67 C89 P90 I94 C118 I119 Y120 C121 G122 C124
BS02 SF4 9 C79 I80 A81 C82 K83 L84 C85 Y111 C128 A132 I133 C79 I80 A81 C82 K83 L84 C85 Y111 C128 A132 I133
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005515 protein binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016491 oxidoreductase activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0009060 aerobic respiration
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pw6, PDBe:8pw6, PDBj:8pw6
PDBsum8pw6
PubMed38575788
UniProtQ8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (Gene Name=Ndufs8)

[Back to BioLiP]