Structure of PDB 8p2g Chain 9

Receptor sequence
>8p2g9 (length=37) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
3D structure
PDB8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chain9
Resolution2.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 9 M1 K2 R4 P5 S6 V7 K8 E12 K18 R19 K20 P30 K31 K33 R35 Q36 G37 M1 K2 R4 P5 S6 V7 K8 E12 K18 R19 K20 P30 K31 K33 R35 Q36 G37
BS02 ZN 9 C11 C14 C27 H32 C11 C14 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum8p2g
PubMed38902339
UniProtQ2FW29|RL36_STAA8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]