Structure of PDB 8oeq Chain 9

Receptor sequence

>8oeq9 (length=126) Species: 5476 (Candida albicans) [Search protein sequence]

AKISQDVSSSRSKARKAYFTASSVERRVLLSAPLSKELRQQYNVKSLPIR
QNDEVLVVRGSKKGSEGKVNSVYRLKFAIQVDKLQKEKSNGASVPINIHP
SKVVITKLHLDKDRKALIQRKGGKAE

3D structure

PDB

8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.3 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	9	A2 K3 I4 Q6 V8 S9 S10 R12 K14 A15 R16 Y19 V29 L30 S32 P34 K37 R40 S47 R60 G61 S62 K87 K89 S90 H100 S102 K103 K122	A1 K2 I3 Q5 V7 S8 S9 R11 K13 A14 R15 Y18 V28 L29 S31 P33 K36 R39 S46 R59 G60 S61 K86 K88 S89 H99 S101 K102 K121
BS02	rna	9	R12 S13 R16 K17 F20 S24 R28 R51 Q52 V73 Y74 R75 L76 L111 D112 K113 D114 K116 R121	R11 S12 R15 K16 F19 S23 R27 R50 Q51 V72 Y73 R74 L75 L110 D111 K112 D113 K115 R120
BS03	MG	9	P34 V104	P33 V103

External links