Structure of PDB 8jr1 Chain 9

Receptor sequence
>8jr19 (length=81) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
3D structure
PDB8jr1 Structure of Mycobacterium tuberculosis ATP synthase
Chain9
Resolution3.17 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UTI 9 A62 A63 I66 A62 A63 I66
BS02 UTI 9 E61 Y64 F65 E61 Y64 F65
Gene Ontology
Molecular Function
GO:0008289 lipid binding
GO:0015078 proton transmembrane transporter activity
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jr1, PDBe:8jr1, PDBj:8jr1
PDBsum8jr1
PubMed38961288
UniProtP9WPS1|ATPL_MYCTU ATP synthase subunit c (Gene Name=atpE)

[Back to BioLiP]