Structure of PDB 8ipx Chain 9

Receptor sequence

>8ipx9 (length=86) Species: 9606 (Homo sapiens)

RSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPLPGGGLHRCLACARY
FIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERA

3D structure

• PDB: 8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Chain: 9
• Resolution: 4.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	9	R3 S4 R5 R6 T7 G8 H10 R11 A12 H13 L15 R17 K22 R23 R68 N75 T78 R81 K83 D84 K87 R88	R1 S2 R3 R4 T5 G6 H8 R9 A10 H11 L13 R15 K20 R21 R49 N56 T59 R62 K64 D65 K68 R69

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:1990275 preribosome binding

Biological Process

• GO:0042254 ribosome biogenesis
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
• PDBsum: 8ipx
• PubMed: 37491604
• UniProt: O00488|ZN593_HUMAN Zinc finger protein 593 (Gene Name=ZNF593)