Structure of PDB 8ine Chain 9

Receptor sequence

>8ine9 (length=97) Species: 9606 (Homo sapiens)

RSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPLPGGGLHRCLACARY
FIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRR

3D structure

• PDB: 8ine Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Chain: 9
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	9	R3 S4 R5 R6 T7 G8 H10 R11 A12 H13 S14 L15 R17 R23 R24 R68 F70 N75 T78 K83 D84 K87 K90	R1 S2 R3 R4 T5 G6 H8 R9 A10 H11 S12 L13 R15 R21 R22 R49 F51 N56 T59 K64 D65 K68 K71

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:1990275 preribosome binding

Biological Process

• GO:0042254 ribosome biogenesis
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8ine, PDBe:8ine, PDBj:8ine
• PDBsum: 8ine
• PubMed: 37491604
• UniProt: O00488|ZN593_HUMAN Zinc finger protein 593 (Gene Name=ZNF593)