Structure of PDB 8htu Chain 9

Receptor sequence

>8htu9 (length=221) Species: 3218 (Physcomitrium patens) [Search protein sequence]

MTGIAEWYKVYGKSVAPDQDARAPYYGPNRPLWKGPFTKPKDVPEYLKGE
YPGDYGCDIFKLARLPANYARLRTQELMNGRWAMLGITGCLTPELINSNS
TPGFEPVWFNTGAQIFSDAGIDYLGINAHSLFAVIVVQALLMGLAEYARI
KFVPEGADPFYPGGKTFDPLGFSSDPEILAELKVKEIKNGRLAMMAMAGL
FAQGAVTGVSPLQNLHDWLHL

3D structure

PDB

8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	9	W119 K120 G121 F123 Y141 C143	W33 K34 G35 F37 Y55 C57
BS02	CLA	9	L133 Y141 C143 L148 L158 E162 R281 M284 M285	L47 Y55 C57 L62 L72 E76 R191 M194 M195
BS03	CLA	9	Q161 N165 F291	Q75 N79 F201
BS04	CLA	9	T174 G175 T178 F190 T197 Y209 L210	T88 G89 T92 F104 T111 Y123 L124
BS05	CHL	9	I216 N217 A218 A223 V224	I126 N127 A128 A133 V134
BS06	CHL	9	I201 V224 Q228 M232	I115 V134 Q138 M142
BS07	CHL	9	F195 G198 A199 I225 Q228	F109 G112 A113 I135 Q138
BS08	CHL	9	R167 W168 A235 A238 R239 F250 P252 F257	R81 W82 A145 A148 R149 F160 P162 F167
BS09	CLA	9	M164 N165 W168 E236 R239	M78 N79 W82 E146 R149
BS10	CLA	9	M170 Y251 P252 G253 F262 S263 L272 K273 E276 N279	M84 Y161 P162 G163 F172 S173 L182 K183 E186 N189
BS11	CLA	9	Y111 K275 K278	Y25 K185 K188
BS12	CLA	9	K275 N279 L282	K185 N189 L192
BS13	CLA	9	M285 A286 G289 Q293 W308	M195 A196 G199 Q203 W218

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum	8htu
PubMed	37474782
UniProt	A0A2K1KKR9

[Back to BioLiP]