Structure of PDB 8a5i Chain 9

Receptor sequence
>8a5i9 (length=36) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence]
MKVRPSVKPMCEKCKVIRRKGKVMVICENPKHKQKQ
3D structure
PDB8a5i Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
Chain9
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 9 M1 K2 R4 P5 S6 V7 K8 V16 R19 K20 K22 P30 K31 K33 K35 Q36 M1 K2 R4 P5 S6 V7 K8 V16 R19 K20 K22 P30 K31 K33 K35 Q36
BS02 ZN 9 C11 C14 C27 H32 C11 C14 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a5i, PDBe:8a5i, PDBj:8a5i
PDBsum8a5i
PubMed36300626
UniProtP66290|RL36_LISMO Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]