Structure of PDB 7zqd Chain 9

Receptor sequence

>7zqd9 (length=186) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

ARPTWLPGLNPPAHLKGALAGDNGFDPLGLGQDEGRLKWYAEAEKTNGRW
AMMAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIVMGFLEIKR
YQGFKQTGTSGFINSFPFDPAGMNSPSMATKEVKNGRLAMVAFIGFCVQA
LATRTQPIEGLTAHLADPFGKNITYYLTHLPETLGS

3D structure

PDB

7zqd Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	9	P29 T30 W31 P33 N49	P3 T4 W5 P7 N23
BS02	CLA	9	L45 D48 N49 F51 G57 Y66 A67 E70 N73 R163 M166	L19 D22 N23 F25 G31 Y40 A41 E44 N47 R137 M140
BS03	CLA	9	Y66 A69 N73 I170	Y40 A43 N47 I144
BS04	CLA	9	G83 Q87 V92	G57 Q61 V66
BS05	CHL	9	W76 Y104 L111 E115	W50 Y78 L85 E89
BS06	CHL	9	W97 G100 E115	W71 G74 E89
BS07	CLA	9	W65 A69 T72 N73 W76 E123 R126	W39 A43 T46 N47 W50 E97 R100
BS08	CLA	9	R75 M78 M79 S136 G137 P143 F144 M149 M154 A155 E158 N161	R49 M52 M53 S110 G111 P117 F118 M123 M128 A129 E132 N135
BS09	CLA	9	K157 K160 N161 L164	K131 K134 N135 L138
BS10	CLA	9	K157 N161 L164	K131 N135 L138
BS11	CLA	9	G171 V174 Q175 T179 G186 I199 Y202	G145 V148 Q149 T153 G160 I173 Y176
BS12	CLA	9	H190 L191 P194 F195	H164 L165 P168 F169

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zqd, PDBe:7zqd, PDBj:7zqd
PDBsum	7zqd
PubMed	36229605
UniProt	A8ITV3

[Back to BioLiP]