Structure of PDB 7xxf Chain 9

Receptor sequence
>7xxf9 (length=45) Species: 1071 (Rhodopila globiformis) [Search protein sequence]
MWRMWLLFDPRRILVALGVFLFVLALLIHFILLSTDRFNWLDGPH
3D structure
PDB7xxf An LH1-RC photocomplex from an extremophilic phototroph provides insight into origins of two photosynthesis proteins.
Chain9
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide 9 M1 R3 M1 R3
BS02 I7D 9 L17 F20 L17 F20
BS03 U10 9 L14 G18 F22 L14 G18 F22
BS04 I7D 9 F22 L26 H29 F30 F22 L26 H29 F30
BS05 BCL 9 L21 H29 W40 L21 H29 W40
BS06 BCL 9 M1 L21 A25 I28 H29 F38 M1 L21 A25 I28 H29 F38
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xxf, PDBe:7xxf, PDBj:7xxf
PDBsum7xxf
PubMed36344631
UniProtA0A2S6NEK3

[Back to BioLiP]