Structure of PDB 7pt7 Chain 9

Receptor sequence
>7pt79 (length=337) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
EWQTNWKKIMKRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGA
QITQFFDTTVTIVITRRSVENIYLLKDTDILSRAKKNYMKVWSYEKAARF
LKNLDVDLDHPTLSNLLHNEKLYGPTDRDPRTKRDDIHYFKYPHVYLYDL
WQTWAPIITLEWKPQELTNLDELPYPILKIGSFGRCPFIGDRNYDESSYK
RVVKRYSRDKANKKYALQLRALFQYHADTLLNTSKNLIFIPHTCNDSTKS
FKKWMQEKAKGNGLGPTRASVMSKNMKSLSRLMVDRKLGVVKNSGYCENC
RVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIENLR
3D structure
PDB7pt7 The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
Chain9
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN 9 C664 H674 H680 C300 H310 H316
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0043539 protein serine/threonine kinase activator activity
GO:0046872 metal ion binding
Biological Process
GO:0001100 negative regulation of exit from mitosis
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006279 premeiotic DNA replication
GO:0007059 chromosome segregation
GO:0010571 positive regulation of nuclear cell cycle DNA replication
GO:0033314 mitotic DNA replication checkpoint signaling
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0060903 positive regulation of meiosis I
GO:1901987 regulation of cell cycle phase transition
GO:1903343 positive regulation of meiotic DNA double-strand break formation
GO:1903468 positive regulation of DNA replication initiation
GO:1905561 positive regulation of kinetochore assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0031431 Dbf4-dependent protein kinase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pt7, PDBe:7pt7, PDBj:7pt7
PDBsum7pt7
PubMed35614055
UniProtP32325|DBF4_YEAST DDK kinase regulatory subunit DBF4 (Gene Name=DBF4)

[Back to BioLiP]