Structure of PDB 7pip Chain 9

Receptor sequence

>7pip9 (length=393) Species: 272634 (Mycoplasmoides pneumoniae M129)

AREKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEGKSAATRYDQID
KAPEEKARGITINSAHVEYSSDKRHYAHVDCPGHADYIKNMITGAAQMDG
AILVVSATDSVMPQTREHILLARQVGVPRMVVFLNKCDIATDEEVQELVA
EEVRDLLTSYGFDGKNTPIIYGSALKALEGDPKWEAKIHDLMNAVDEWIP
TPEREVDKPFLLAIEDTMTITGRGTVVTGRVERGELKVGQEIEIVGLRPI
RKAVVTGIEMFKKELDSAMAGDNAGVLLRGVDRKEVERGQVLAKPGSIKP
HKKFKAEIYALKKEEGGRHTGFLNGYRPQFYFRTTDVTGSISLPENTEMV
LPGDNTSITVELIAPIACEKGSKFSIREGGRTVGAGSVTEVLE

3D structure

• PDB: 7pip Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: 9
• Resolution: 9.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	9	A2 T222 G223 R224 G225 T257 R280	A1 T221 G222 R223 G224 T256 R279
BS02	rna	9	K52 I63 N64 D87 Y88 N91 M219 T220 K263 R284 R319 H320 T321 G326 Y327 R328 Q330 D337 T339 E379 G380 R382	K51 I62 N63 D86 Y87 N90 M218 T219 K262 R283 R318 H319 T320 G325 Y326 R327 Q329 D336 T338 E378 G379 R381

Gene Ontology

Molecular Function

• GO:0001968 fibronectin binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0009897 external side of plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:7pip, PDBe:7pip, PDBj:7pip
• PDBsum: 7pip
• PubMed: 36171285
• UniProt: P23568|EFTU_MYCPN Elongation factor Tu (Gene Name=tuf)