Structure of PDB 7oy8 Chain 9

Receptor sequence
>7oy89 (length=46) Species: 269796 (Rhodospirillum rubrum ATCC 11170) [Search protein sequence]
SGITEGEAKEFHKIFTSSILVFFGVAAFAHLLVWIWRPWVPGPNGY
3D structure
PDB7oy8 Cryo-EM structure of the Rhodospirillum rubrum RC-LH1 complex at 2.5 angstrom.
Chain9
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 07D 9 F31 A35 A38 H39 F22 A26 A29 H30
BS02 CRT 9 F20 I23 F24 S27 I28 F11 I14 F15 S18 I19
BS03 07D 9 F31 F32 A35 H39 V42 W48 F22 F23 A26 H30 V33 W39
BS04 07D 9 A38 L41 A29 L32
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oy8, PDBe:7oy8, PDBj:7oy8
PDBsum7oy8
PubMed34402504
UniProtQ2RQ23|LHB_RHORT Light-harvesting protein B-870 beta chain (Gene Name=Rru_A2977)

[Back to BioLiP]