Structure of PDB 7oi7 Chain 9

Receptor sequence
>7oi79 (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]
ADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPD
LTGFKLKPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDNLEKYGFE
PTQEGKLFQLYPRNFLR
3D structure
PDB7oi7 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Chain9
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 9 R17 M18 K20 S23 K24 R25 G26 P27 R28 S29 F30 R31 G32 R33 K34 G35 K39 G40 L44 S46 G47 W48 F50 V51 Q52 R3 M4 K6 S9 K10 R11 G12 P13 R14 S15 F16 R17 G18 R19 K20 G21 K25 G26 L30 S32 G33 W34 F36 V37 Q38
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0006915 apoptotic process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi7, PDBe:7oi7, PDBj:7oi7
PDBsum7oi7
PubMed34315873
UniProtQ8IXM3|RM41_HUMAN Large ribosomal subunit protein mL41 (Gene Name=MRPL41)

[Back to BioLiP]